PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Araha.30146s0002.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family Dof
Protein Properties Length: 342aa    MW: 36690.3 Da    PI: 9.5413
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Araha.30146s0002.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof123.66.6e-3994153362
                zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                           e alkcprCds+ntkfCy+nny+l+qPr+fCkaCrryWt+GGalrnvPvGgg+r+nkk +
  Araha.30146s0002.1.p  94 EGALKCPRCDSANTKFCYFNNYNLTQPRHFCKACRRYWTRGGALRNVPVGGGCRRNKKGK 153
                           5689****************************************************9865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3778148IPR003851Zinc finger, Dof-type
PfamPF027011.6E-3296151IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.68397151IPR003851Zinc finger, Dof-type
PROSITE patternPS01361099135IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MVFSSVSSFL DPPINWPQSA NSNNHPNHPH HHQLQENGGL VSGHHQVLSH HFPQNPNPNH  60
HHVDTAAAAT VDPSSLNGQA AERARLAKNS QPPEGALKCP RCDSANTKFC YFNNYNLTQP  120
RHFCKACRRY WTRGGALRNV PVGGGCRRNK KGKSGNSKSS SSSQNKQSTS MVNATIPTTT  180
SNVQLQTNSQ FPFLPDLQNL TQLGGIGLNL AAINGNNGGN GNTSSSFLNE LGFFHGGNTS  240
GSVMGNNNNE NNIMTSLGSA SHFALFDRTM GLYNFPNEGN MGLSFIGASR VSQTAQVKME  300
DNHLGSINRP VSGMTSPGNQ SNQYWTGQSL PGSSSNDHHL M*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00281DAPTransfer from AT2G28810Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0328770.0BT032877.1 Arabidopsis thaliana unknown protein (At2g28810) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_850126.10.0Dof zinc finger protein DOF2.2
SwissprotQ9ZV330.0DOF22_ARATH; Dof zinc finger protein DOF2.2
TrEMBLD7LK870.0D7LK87_ARALL; Dof-type zinc finger domain-containing protein
STRINGAT2G28810.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM53361749
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28810.11e-166Dof family protein